Pay in 4 interest-free payments of $35.00 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
DENND4A Antibody
MFN2 acts independently of the cytoskeleton
Abbreviation: GPR182
BS65879-100
DGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVN
FLCN Polyclonal Antibody - E-AB-67765 Size:60μL DENND4A AntibodyFLCN Polyclonal Antibody Sizes: 60L, 120L, 200L Catalogue Numbers: E AB 67765 60, E AB 67765 120, E AB 67765 200 Citations, Manuals and MSDS Available upon request. Abbreviation: FLCN Target Synonym: FLCN; BHD; FLCL Research Areas: Cancer Conjugation: Unconjugated Host: Rabbit Species Reactivity: Human Application: WB, IHC Isotype: IgG Clonality: Polyclonal UNIProt ID: Q8NFG4 Background: This gene is located within the Smith Magenis syndrome region on
US$ 19.99
US$ 19.99
US$ 17.99
US$ 19.99
US$ 36.99
US$ 17.99
US$ 17.99
US$ 17.99
US$ 19.99
US$ 17.49
US$ 17.49
US$ 24.99
US$ 22.99
US$ 19.99